missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EEF1E1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55640-25ul
This item is not returnable.
View return policy
Description
EEF1E1 Polyclonal specifically detects EEF1E1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| EEF1E1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3, ARS-interacting multifunctional protein 3, Elongation factor p18, eukaryotic translation elongation factor 1 epsilon 1, eukaryotic translation elongation factor 1 epsilon-1, Multisynthase complex auxiliary component p18, P18, p18 component of aminoacyl-tRNA synthetase complex | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| EEF1E1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH | |
| 25 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 9521 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction