missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ferric Chelate Reductase 1 Like Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58836-25ul
This item is not returnable.
View return policy
Description
Ferric Chelate Reductase 1 Like Polyclonal specifically detects Ferric Chelate Reductase 1 Like in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| C9orf4 | |
| Unconjugated | |
| PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide | |
| FRRS1L | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC | |
| 25 μL | |
| Primary | |
| Specificity of human Ferric Chelate Reductase 1 Like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Brain protein CG-6, C9orf4, CG6, CG-6, chromosome 9 open reading frame 4, ferric-chelate reductase 1-like, hypothetical protein LOC23732 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 23732 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu