missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ferric Chelate Reductase 1 Like Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | C9orf4 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18218232
|
Novus Biologicals
NBP2-58836 |
100 μL |
€ 624.00 € 590.10 / 100µL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18659057
|
Novus Biologicals
NBP2-58836-25ul |
25 μL |
€ 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Ferric Chelate Reductase 1 Like Polyclonal specifically detects Ferric Chelate Reductase 1 Like in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| C9orf4 | |
| Polyclonal | |
| Rabbit | |
| Brain protein CG-6, C9orf4, CG6, CG-6, chromosome 9 open reading frame 4, ferric-chelate reductase 1-like, hypothetical protein LOC23732 | |
| FRRS1L | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Unconjugated | |
| RUO | |
| 23732 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC | |
| Primary | |
| Specificity of human Ferric Chelate Reductase 1 Like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title