missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FGF-12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | FGF-12 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18203124
|
Novus Biologicals
NBP2-57305 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18608126
|
Novus Biologicals
NBP2-57305-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FGF-12 Polyclonal specifically detects FGF-12 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| FGF-12 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2257 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| FGF-12, FGF12B, FHF-1, FHF1Fibroblast growth factor homologous factor 1, fibroblast growth factor 12, fibroblast growth factor 12B, fibroblast growth factor FGF-12b, Myocyte-activating factor | |
| FGF12 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title