missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCLM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-83361-25ul
This item is not returnable.
View return policy
Description
GCLM Polyclonal antibody specifically detects GCLM in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| GCLM | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Gamma-ECS regulatory subunit, Gamma-glutamylcysteine synthetase regulatory subunit, GCS light chain, GLCLRglutamate--cysteine ligase regulatory subunit, glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), regulatory(30.8kD), Glutamate--cysteine ligase modifier subunit, glutamate-cysteine ligase regulatory protein, glutamate-cysteine ligase, modifier subunit, GSC light chain | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE | |
| 25 μL | |
| Cancer | |
| 2730 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction