missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCLM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 386.00 - € 529.00
Specifications
| Antigen | GCLM |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20-1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18425860
|
Novus Biologicals
NBP1-83361 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18468700
|
Novus Biologicals
NBP1-83361-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GCLM Polyclonal antibody specifically detects GCLM in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| GCLM | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2730 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Gamma-ECS regulatory subunit, Gamma-glutamylcysteine synthetase regulatory subunit, GCS light chain, GLCLRglutamate--cysteine ligase regulatory subunit, glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), regulatory(30.8kD), Glutamate--cysteine ligase modifier subunit, glutamate-cysteine ligase regulatory protein, glutamate-cysteine ligase, modifier subunit, GSC light chain | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title