missing translation for 'onlineSavingsMsg'
Learn More

GGT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-56998-25ul

Product Code. 18685387

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products »

This item is not returnable. View return policy

Description

GGT1 Polyclonal specifically detects GGT1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	GGT1
Classification	Polyclonal
Dilution	Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias	CD224, CD224 antigen, D22S672, D22S732, EC 2.3.2.2, gamma-glutamyl transpeptidase, gamma-glutamyltransferase 1MGC96904, gamma-glutamyltranspeptidase 1, GGT 1, GGTMGC96963, glutamyl transpeptidase, GTG, MGC96892
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype	IgG

Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols	GGT1
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MFNSSEQSQKGGLSVAVPGEIRGYELAHQRHG
Quantity	25 μL
Research Discipline	Cancer
Gene ID (Entrez)	2678
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

GGT1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions