missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GRID2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35897-20ul
This item is not returnable.
View return policy
Description
GRID2 Polyclonal antibody specifically detects GRID2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| GRID2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| B230104L07Rik, cpr, creeper, gluR delta-2 subunit, GluRdelta2, glutamate receptor delta-2 subunit, glutamate receptor, ionotropic, delta 2, ho, hotfoot, Lc, lurcher, minisatellite 10ac detected by probe MMS10, MMS10-AC, Ms10ac, nmf408, tpr | |
| A synthetic peptide corresponding to a sequence within amino acids 900-1007 of human GRID2 (NP_001501.2).,, Sequence:, IDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI | |
| 20 μL | |
| Neuronal Cell Markers, Neurotransmission | |
| 2895 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering