missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GRID2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | GRID2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228972
|
Novus Biologicals
NBP3-35897-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229439
|
Novus Biologicals
NBP3-35897-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GRID2 Polyclonal antibody specifically detects GRID2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| GRID2 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Neuronal Cell Markers, Neurotransmission | |
| PBS (pH 7.3), 50% glycerol | |
| 2895 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| B230104L07Rik, cpr, creeper, gluR delta-2 subunit, GluRdelta2, glutamate receptor delta-2 subunit, glutamate receptor, ionotropic, delta 2, ho, hotfoot, Lc, lurcher, minisatellite 10ac detected by probe MMS10, MMS10-AC, Ms10ac, nmf408, tpr | |
| A synthetic peptide corresponding to a sequence within amino acids 900-1007 of human GRID2 (NP_001501.2).,, Sequence:, IDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title