missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GSK-3 beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-90359-25ul
This item is not returnable.
View return policy
Description
GSK-3 beta Polyclonal antibody specifically detects GSK-3 beta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| GSK-3 beta | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EC 2.7.11, EC 2.7.11.26, glycogen synthase kinase 3 beta, glycogen synthase kinase-3 beta, GSK-3 beta, GSK3beta isoform | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGS | |
| 25 μL | |
| Cancer, Hypoxia, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction, Wnt Signaling Pathway | |
| 2932 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction