missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GSK-3 beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 430.00
Specifications
| Antigen | GSK-3 beta |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|
18451202
|
Novus Biologicals
NBP1-90359 |
0.1 mL |
€ 430.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18411392
|
Novus Biologicals
NBP1-90359-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GSK-3 beta Polyclonal antibody specifically detects GSK-3 beta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Spécification
| GSK-3 beta | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Hypoxia, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction, Wnt Signaling Pathway | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2932 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 2.7.11, EC 2.7.11.26, glycogen synthase kinase 3 beta, glycogen synthase kinase-3 beta, GSK-3 beta, GSK3beta isoform | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit