missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Histamine H2R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-86082-25ul
This item is not returnable.
View return policy
Description
Histamine H2R Polyclonal specifically detects Histamine H2R in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Histamine H2R | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| gastric receptor 1, Gastric receptor I, H2R, HH2R, histamine H2 receptor, histamine receptor H2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HRH2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR | |
| 25 μL | |
| GPCR, Stem Cell Markers | |
| 3274 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction