missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HMGB3/HMG4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-47434-25ul
This item is not returnable.
View return policy
Description
HMGB3/HMG4 Polyclonal specifically detects HMGB3/HMG4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| HMGB3/HMG4 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| High mobility group protein 2a, High mobility group protein 4, high mobility group protein B3, high-mobility group (nonhistone chromosomal) protein 4, high-mobility group box 3, HMG-2a, HMG2AHMG-4, HMG4MGC90319, non-histone chromosomal protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HMGB3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEE | |
| 25 μL | |
| Chromatin Research, DNA Repair | |
| 3149 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction