missing translation for 'onlineSavingsMsg'
Learn More
Learn More
hnRNP U Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48729
This item is not returnable.
View return policy
Description
hnRNP U Polyclonal antibody specifically detects hnRNP U in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| hnRNP U | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| heterogeneous nuclear ribonucleoprotein U, heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A), hnRNP U, HNRPU, p120, p120 nuclear protein, pp120, SAFA, SAF-AhnRNPU, Scaffold attachment factor A, U21.1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDT | |
| 0.1 mL | |
| Cellular Markers | |
| 3192 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction