missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HspA12B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88293-25ul
This item is not returnable.
View return policy
Description
HspA12B Polyclonal specifically detects HspA12B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| HspA12B | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:200 | |
| C20orf60, chromosome 20 open reading frame 60, dJ1009E24.2, FLJ32150, heat shock 70 kDa protein 12B, heat shock 70kD protein 12B, MGC131912 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 116835 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HSPA12B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVA | |
| 25 μL | |
| Primary | |
| Specificity of human HspA12B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction