missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HspA12B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 288.00 - € 539.00
Specifications
| Antigen | HspA12B |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18481011
|
Novus Biologicals
NBP1-88293-25ul |
25 μL |
€ 288.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18272106
|
Novus Biologicals
NBP1-88293 |
0.1 mL |
€ 539.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HspA12B Polyclonal specifically detects HspA12B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HspA12B | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 116835 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| C20orf60, chromosome 20 open reading frame 60, dJ1009E24.2, FLJ32150, heat shock 70 kDa protein 12B, heat shock 70kD protein 12B, MGC131912 | |
| HSPA12B | |
| IgG | |
| Affinity Purified | |
| Specificity of human HspA12B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title