missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ING2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05515-25ul
This item is not returnable.
View return policy
Description
ING2 Polyclonal antibody specifically detects ING2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| ING2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ING1Linhibitor of growth family, member 1-like, ING1Lp, Inhibitor of growth 1-like protein, inhibitor of growth family, member 2, inhibitor of growth protein 2, p33ING2p32 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRAL | |
| 25 μg | |
| Apoptosis, DNA Repair | |
| 3622 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction