missing translation for 'onlineSavingsMsg'
Learn More
Learn More
INSIG-1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33431-100ul
This item is not returnable.
View return policy
Description
INSIG-1 Monoclonal antibody specifically detects INSIG-1 in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
Specifications
| INSIG-1 | |
| Monoclonal | |
| ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CL6, CL-6, INSIG-1, INSIG-1 membrane protein, insulin induced gene 1, insulin-induced gene 1 protein, MGC1405 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 177-277 of human INSIG-1 (NP_005533.2).,, Sequence:, ASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD | |
| 100 μL | |
| Cholesterol Metabolism, ER Markers, Lipid and Metabolism, Signal Transduction | |
| 3638 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction