missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Involucrin Rabbit anti-Human, Mouse, Rat, Clone: 8H7B3, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-15461-20UL
This item is not returnable.
View return policy
Description
Involucrin Monoclonal antibody specifically detects Involucrin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Involucrin | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 8H7B3 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| involucrin | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Involucrin (P07476). KAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQE | |
| 20 μg | |
| Extracellular Matrix | |
| 3713 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction