missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Involucrin Rabbit anti-Human, Mouse, Rat, Clone: 8H7B3, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 207.00 - € 497.00
Specifications
| Antigen | Involucrin |
|---|---|
| Clone | 8H7B3 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18088895
|
Novus Biologicals
NBP3-15461-20UL |
20 μg |
€ 207.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18326532
|
Bio-Techne
NBP3-15461-100UL |
100 μg |
€ 497.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Involucrin Monoclonal antibody specifically detects Involucrin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Involucrin | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| involucrin | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Involucrin (P07476). KAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 8H7B3 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Extracellular Matrix | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 3713 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title