missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IPCEF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68603
This item is not returnable.
View return policy
Description
IPCEF1 Polyclonal antibody specifically detects IPCEF1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| IPCEF1 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| interaction protein for cytohesin exchange factors 1, interactor protein for cytohesin exchange factors 1, KIAA0403interaction protein for cytohesin exchange factors 1 Interaction protein forcytohesin exchange factors 1, phosphoinositide binding protein PIP3-E, Phosphoinositide-binding protein PIP3-E, PIP3-E, RP3-402L9.2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 26034 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction