missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IPCEF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | IPCEF1 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18645648
|
Novus Biologicals
NBP2-68603-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18644687
|
Novus Biologicals
NBP2-68603 |
100 μg |
€ 572.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IPCEF1 Polyclonal antibody specifically detects IPCEF1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| IPCEF1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| interaction protein for cytohesin exchange factors 1, interactor protein for cytohesin exchange factors 1, KIAA0403interaction protein for cytohesin exchange factors 1 Interaction protein forcytohesin exchange factors 1, phosphoinositide binding protein PIP3-E, Phosphoinositide-binding protein PIP3-E, PIP3-E, RP3-402L9.2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 26034 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title