missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kir2.2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35430-20ul
This item is not returnable.
View return policy
Description
Kir2.2 Polyclonal antibody specifically detects Kir2.2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Kir2.2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| ATP-sensitive inward rectifier potassium channel 12, hIRK, hIRK1, hkir2.2x, Inward rectifier K(+) channel Kir2.2, Inward rectifier K(+) channel Kir2.2v, inward rectifier K(+) channel Kir2.6, IRK2IRK-2, kcnj12x, KCNJN1FLJ14167, Kir2.2, Kir2.2v, Potassium channel, inwardly rectifying subfamily J member 12, potassium inwardly-rectifying channel, subfamily J, inhibitor 1, potassium inwardly-rectifying channel, subfamily J, member 12 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human Kir2.2 (NP_066292.2).,, Sequence:, TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI | |
| 20 μL | |
| Signal Transduction | |
| 3768 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction