missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KIR2DS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-98548
409.70 EUR valid until 2025-12-16
BEST PRICE on Promo! Use promo code "24090" to get your promotional price.
This item is not returnable.
View return policy
Description
KIR2DS2 Polyclonal specifically detects KIR2DS2 in Human samples. It is validated for Western Blot.
Specifications
| KIR2DS2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 183ActI, CD158b, CD158J, cl-49, killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2, NKAT5, p58 KIR | |
| Rabbit | |
| 32 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_036444 | |
| KIR2DS2 | |
| The immunogen for this antibody is KIR2DS2 - N-terminal region. Peptide sequence ETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQ. | |
| Affinity purified | |
| RUO | |
| 100132285 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction