missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KIR2DS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | KIR2DS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KIR2DS2 Polyclonal specifically detects KIR2DS2 in Human samples. It is validated for Western Blot.Specifications
| KIR2DS2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 183ActI, CD158b, CD158J, cl-49, killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2, NKAT5, p58 KIR | |
| KIR2DS2 | |
| IgG | |
| 32 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_036444 | |
| 100132285 | |
| The immunogen for this antibody is KIR2DS2 - N-terminal region. Peptide sequence ETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title