missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Laminin gamma 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 285.00 - € 500.00
Specifications
| Antigen | Laminin gamma 1 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18474322
|
Novus Biologicals
NBP1-87718-25ul |
25 μL |
€ 285.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18797723
|
Novus Biologicals
NBP1-87718 |
€ 500.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
Laminin gamma 1 Polyclonal specifically detects Laminin gamma 1 in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Laminin gamma 1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| LAMB2Laminin-7 subunit gamma, Laminin B2 chain, laminin subunit gamma-1, laminin, gamma 1 (formerly LAMB2), Laminin-1 subunit gamma, Laminin-10 subunit gamma, Laminin-11 subunit gamma, Laminin-2 subunit gamma, Laminin-3 subunit gamma, Laminin-4 subunit gamma, Laminin-6 subunit gamma, Laminin-8 subunit gamma, Laminin-9 subunit gamma, MGC87297, S-LAM gamma, S-laminin subunit gamma | |
| LAMC1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cytoskeleton Markers, Extracellular Matrix, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3915 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title