missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lass5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35736-20ul
This item is not returnable.
View return policy
Description
Lass5 Polyclonal antibody specifically detects Lass5 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Lass5 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| CerS5, FLJ25304, LAG1 homolog, ceramide synthase 5, LAG1 longevity assurance homolog 5, LAG1 longevity assurance homolog 5 (S. cerevisiae), MGC45411, Trh4 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lass5 (NP_001268660.1).,, Sequence:, MMKPRPKRFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYG | |
| 20 μL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 91012 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction