missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LATS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14184
This item is not returnable.
View return policy
Description
LATS2 Polyclonal specifically detects LATS2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| LATS2 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| EC 2.7.11, EC 2.7.11.1, FLJ13161, Kinase phosphorylated during mitosis protein, KPM, Large tumor suppressor homolog 2, LATS (large tumor suppressor, Drosophila) homolog 2, LATS, large tumor suppressor, homolog 2 (Drosophila), serine/threonine kinase KPM, Serine/threonine-protein kinase kpm, serine/threonine-protein kinase LATS2, Warts-like kinase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| LATS2 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: HLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKR | |
| 0.1 mL | |
| Apoptosis, Cancer, Cell Cycle and Replication, GPCR, Tumor Suppressors | |
| 26524 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction