missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LATS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 500.00
Specifications
| Antigen | LATS2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18458341
|
Novus Biologicals
NBP2-14184-25ul |
25ul |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18066529
|
Novus Biologicals
NBP2-14184 |
0.1 mL |
€ 500.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LATS2 Polyclonal specifically detects LATS2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| LATS2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.11, EC 2.7.11.1, FLJ13161, Kinase phosphorylated during mitosis protein, KPM, Large tumor suppressor homolog 2, LATS (large tumor suppressor, Drosophila) homolog 2, LATS, large tumor suppressor, homolog 2 (Drosophila), serine/threonine kinase KPM, Serine/threonine-protein kinase kpm, serine/threonine-protein kinase LATS2, Warts-like kinase | |
| LATS2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cell Cycle and Replication, GPCR, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 26524 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: HLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title