missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRWD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37930-20ul
This item is not returnable.
View return policy
Description
LRWD1 Polyclonal antibody specifically detects LRWD1 in Human samples. It is validated for ELISA,Western Blot
Specifications
| LRWD1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| DKFZp434K1815, leucine-rich repeats and WD repeat domain containing 1, ORCAleucine-rich repeat and WD repeat-containing protein 1, ORC-associated protein, origin recognition complex associated, Origin recognition complex-associated protein | |
| A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LRWD1 (NP_690852.1).,, Sequence:, ASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL | |
| 20 μL | |
| Cell Biology | |
| 222229 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction