missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LYRM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | LYRM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LYRM1 Polyclonal specifically detects LYRM1 in Human samples. It is validated for Western Blot.Specifications
| LYRM1 | |
| Polyclonal | |
| Rabbit | |
| O43325 | |
| 57149 | |
| Synthetic peptides corresponding to LYRM1(LYR motif containing 1) The peptide sequence was selected from the middle region of LYRM1. Peptide sequence KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A211C6.1, LYR motif containing 1, LYR motif-containing protein 1 | |
| LYRM1 | |
| IgG | |
| 14 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title