missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAGI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58071-25ul
This item is not returnable.
View return policy
Description
MAGI1 Polyclonal specifically detects MAGI1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| MAGI1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| AIP-3, AIP3WW and PDZ domain-containing protein 1, membrane associated guanylate kinase, WW and PDZ domain containing 1, TNRC19BAP-1, WWP3WW domain-containing protein 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| MAGI1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD | |
| 25 μL | |
| Cancer | |
| 9223 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido