missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Marapsin/Pancreasin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21249-100ul
This item is not returnable.
View return policy
Description
Marapsin/Pancreasin Polyclonal antibody specifically detects Marapsin/Pancreasin in Human samples. It is validated for Immunofluorescence
Specifications
| Marapsin/Pancreasin | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| CAPH2, channel-activating protease 2, EC 3.4.21, EC 3.4.21.-, EC 3.4.21.4, EC 3.4.21.43, marapsin, MPNMarapsin, Pancreasin, protease, serine 27, serine protease 27 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: NTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNC | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 83886 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction