missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Marapsin/Pancreasin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 450.00 - € 648.00
Specifications
| Antigen | Marapsin/Pancreasin |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18634634
|
Novus Biologicals
NBP3-21249-25ul |
25 μg |
€ 450.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18697604
|
Novus Biologicals
NBP3-21249-100ul |
100 μg |
€ 648.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Marapsin/Pancreasin Polyclonal antibody specifically detects Marapsin/Pancreasin in Human samples. It is validated for ImmunofluorescenceSpecifications
| Marapsin/Pancreasin | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CAPH2, channel-activating protease 2, EC 3.4.21, EC 3.4.21.-, EC 3.4.21.4, EC 3.4.21.43, marapsin, MPNMarapsin, Pancreasin, protease, serine 27, serine protease 27 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: NTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNC | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 83886 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title