missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84848-25ul
This item is not returnable.
View return policy
Description
MARK2 Polyclonal specifically detects MARK2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MARK2 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| EC 2.7.11, EC 2.7.11.1, ELKL motif kinase, ELKL motif kinase 1, EMK-1, EMK1PAR-1, MAP/microtubule affinity-regulating kinase 2MGC99619, PAR1 homolog, Par1b, Ser/Thr protein kinase PAR-1B, serine/threonine protein kinase EMK, serine/threonine-protein kinase MARK2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MARK2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE | |
| 25ul | |
| Protein Kinase | |
| 2011 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction