missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 285.00 - € 529.00
Specifications
| Antigen | MARK2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18408180
|
Novus Biologicals
NBP1-84848-25ul |
25ul |
€ 285.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18795403
|
Novus Biologicals
NBP1-84848 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MARK2 Polyclonal specifically detects MARK2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MARK2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.11, EC 2.7.11.1, ELKL motif kinase, ELKL motif kinase 1, EMK-1, EMK1PAR-1, MAP/microtubule affinity-regulating kinase 2MGC99619, PAR1 homolog, Par1b, Ser/Thr protein kinase PAR-1B, serine/threonine protein kinase EMK, serine/threonine-protein kinase MARK2 | |
| MARK2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2011 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title