missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MBOAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 478.00
Specifications
| Antigen | MBOAT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MBOAT1 Polyclonal specifically detects MBOAT1 in Human samples. It is validated for Western Blot.Specifications
| MBOAT1 | |
| Polyclonal | |
| Rabbit | |
| Q6ZNC8 | |
| 154141 | |
| Synthetic peptides corresponding to MBOAT1(membrane bound O-acyltransferase domain containing 1) The peptide sequence was selected from the N terminal of MBOAT1. Peptide sequence AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dJ434O11.1, EC 2.3.1.-, EC 2.3.1.n6,1-acylglycerophosphoserine O-acyltransferase, LPEAT1, LPLAT 1, LPSAT, lysophosphatidylethanolamine acyltransferase 1, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 1, Lyso-PS acyltransferase, membrane bound O-acyltransferase domain containing 1, Membrane-bound O-acyltransferase domain-containing protein 1, MGC44669, OACT1, O-acyltransferase (membrane bound) domain containing 1, O-acyltransferase domain-containing protein 1 | |
| MBOAT1 | |
| IgG | |
| 56 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title