missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMAB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86602-25ul
This item is not returnable.
View return policy
Description
MMAB Polyclonal specifically detects MMAB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| MMAB | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| Q96EY8 | |
| MMAB | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunofluorescence, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| aquocob(I)alamin vitamin B12s adenosyltransferase, ATP:cob(I)alamin adenosyltransferase, ATP:corrinoid adenosyltransferase, ATR, cblB, c-diamide adenosyltransferase, mitochondrial, cob, Cob(I)alamin adenosyltransferase, cob(I)yrinic acid a, EC 2.5.1.17, methylmalonic aciduria (cobalamin deficiency) cblB type, methylmalonic aciduria (cobalamin deficiency) type B, Methylmalonic aciduria type B protein, MGC20496 | |
| Rabbit | |
| 27 kDa | |
| 25 μL | |
| Proteases & Other Enzymes | |
| 326625 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction