missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMAB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 549.00
Specifications
| Antigen | MMAB |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18404961
|
Novus Biologicals
NBP1-86602-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18287726
|
Novus Biologicals
NBP1-86602 |
0.1 mL |
€ 549.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MMAB Polyclonal specifically detects MMAB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| MMAB | |
| Polyclonal | |
| Rabbit | |
| Proteases & Other Enzymes | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| aquocob(I)alamin vitamin B12s adenosyltransferase, ATP:cob(I)alamin adenosyltransferase, ATP:corrinoid adenosyltransferase, ATR, cblB, c-diamide adenosyltransferase, mitochondrial, cob, Cob(I)alamin adenosyltransferase, cob(I)yrinic acid a, EC 2.5.1.17, methylmalonic aciduria (cobalamin deficiency) cblB type, methylmalonic aciduria (cobalamin deficiency) type B, Methylmalonic aciduria type B protein, MGC20496 | |
| MMAB | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| Unconjugated | |
| RUO | |
| Human | |
| Q96EY8 | |
| 326625 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 27 kDa |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title