missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPL37 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00
Specifications
| Antigen | MRPL37 |
|---|---|
| Dilution | Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Beschreibung
MRPL37 Polyclonal specifically detects MRPL37 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| MRPL37 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 39S ribosomal protein L2, mitochondrial, L2mt, L37mt, MGC878, mitochondrial ribosomal protein L37, MRP-L2MRPL2, MRP-L37, ribosomal protein, mitochondrial, L2, RPML239S ribosomal protein L37, mitochondrial | |
| MRPL37 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51253 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts