missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myelin PLP Antibody (CL10622), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP3-07989-25ul
This item is not returnable.
View return policy
Description
Myelin PLP Monoclonal antibody specifically detects Myelin PLP in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Myelin PLP | |
| Monoclonal | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL10622 | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| HLD1, lipophilin, major myelin proteolipid protein, MMPL, myelin proteolipid protein, PLP, PLP/DM20, PMD, proteolipid protein 1, spastic paraplegia 2, uncomplicated, SPG2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGI | |
| 25 μg | |
| Immune System Diseases, Immunology, Neuroscience, Stem Cell Markers | |
| 5354 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction