missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myelin PLP Antibody (CL10622), Novus Biologicals™
Mouse Monoclonal Antibody
€ 366.00 - € 675.00
Specifications
| Antigen | Myelin PLP |
|---|---|
| Clone | CL10622 |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18631038
|
Novus Biologicals
NBP3-07989-25ul |
25 μg |
€ 366.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18688578
|
Novus Biologicals
NBP3-07989-100ul |
100 μg |
€ 675.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Myelin PLP Monoclonal antibody specifically detects Myelin PLP in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Myelin PLP | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| HLD1, lipophilin, major myelin proteolipid protein, MMPL, myelin proteolipid protein, PLP, PLP/DM20, PMD, proteolipid protein 1, spastic paraplegia 2, uncomplicated, SPG2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGI | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| CL10622 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Immune System Diseases, Immunology, Neuroscience, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol | |
| 5354 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title