missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myelin Protein Zero Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68878-25ul
This item is not returnable.
View return policy
Description
Myelin Protein Zero Polyclonal antibody specifically detects Myelin Protein Zero in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Myelin Protein Zero | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Charcot-Marie-Tooth neuropathy 1B, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, HMSNIB, MPP, Myelin peripheral protein, myelin protein P0, myelin protein zeroDSS, P0 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK | |
| 25 μL | |
| Neuronal Cell Markers, Oligodendrocyte Cell Markers | |
| 4359 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction