missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myelin Protein Zero Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | Myelin Protein Zero |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18643637
|
Novus Biologicals
NBP2-68878-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18673587
|
Novus Biologicals
NBP2-68878 |
100 μg |
€ 593.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Myelin Protein Zero Polyclonal antibody specifically detects Myelin Protein Zero in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Myelin Protein Zero | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuronal Cell Markers, Oligodendrocyte Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 4359 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Charcot-Marie-Tooth neuropathy 1B, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, HMSNIB, MPP, Myelin peripheral protein, myelin protein P0, myelin protein zeroDSS, P0 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title