missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAPB Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94485-0.02ml
This item is not returnable.
View return policy
Description
NAPB Polyclonal antibody specifically detects NAPB in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| NAPB | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| MGC26066, N-ethylmaleimide-sensitive factor attachment protein, beta, SNAP-BETA | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human NAPB (NP_071363.1). MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAAN | |
| 0.02 mL | |
| Signal Transduction | |
| 63908 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu