missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAPB Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 221.00 - € 470.00
Specifications
| Antigen | NAPB |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18652771
|
Novus Biologicals
NBP2-94485-0.02ml |
0.02 mL |
€ 221.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18671101
|
Novus Biologicals
NBP2-94485-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NAPB Polyclonal antibody specifically detects NAPB in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| NAPB | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 63908 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| MGC26066, N-ethylmaleimide-sensitive factor attachment protein, beta, SNAP-BETA | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human NAPB (NP_071363.1). MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAAN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title