missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nav1.5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17744-25UL
This item is not returnable.
View return policy
Description
Nav1.5 Polyclonal antibody specifically detects Nav1.5 in Human samples. It is validated for Immunofluorescence
Specifications
| Nav1.5 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| cardiac sodium channel alpha subunit, cardiac tetrodotoxin-insensitive voltage-dependent sodium channel alpha subunit, CDCD2VF1, HB1sodium channel, voltage-gated, type V, alpha (long QT syndrome 3), HB2, HBBD, HH1CMD1E, ICCD, IVF, LQT3SSS1CMPD2, Nav1.5, PFHB1, Sodium channel protein cardiac muscle subunit alpha, sodium channel protein type 5 subunit alpha, sodium channel protein type V alpha subunit, Sodium channel protein type V subunit alpha, sodium channel, voltage-gated, type V, alpha subunit, Voltage-gated sodium channel subunit alpha Nav1.5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS | |
| 25 μg | |
| Cancer, Hypoxia | |
| 6331 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction