missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nav1.5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 407.00 - € 662.00
Specifications
| Antigen | Nav1.5 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18373623
|
Bio-Techne
NBP3-17744-25UL |
25 μg |
€ 407.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18070264
|
Novus Biologicals
NBP3-17744-100UL |
100 μg |
€ 662.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Nav1.5 Polyclonal antibody specifically detects Nav1.5 in Human samples. It is validated for ImmunofluorescenceSpecifications
| Nav1.5 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Hypoxia | |
| PBS, pH 7.2, 40% glycerol | |
| 6331 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| cardiac sodium channel alpha subunit, cardiac tetrodotoxin-insensitive voltage-dependent sodium channel alpha subunit, CDCD2VF1, HB1sodium channel, voltage-gated, type V, alpha (long QT syndrome 3), HB2, HBBD, HH1CMD1E, ICCD, IVF, LQT3SSS1CMPD2, Nav1.5, PFHB1, Sodium channel protein cardiac muscle subunit alpha, sodium channel protein type 5 subunit alpha, sodium channel protein type V alpha subunit, Sodium channel protein type V subunit alpha, sodium channel, voltage-gated, type V, alpha subunit, Voltage-gated sodium channel subunit alpha Nav1.5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts