missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NFkB p100/p52 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93391-0.1ml
This item is not returnable.
View return policy
Description
NFkB p100/p52 Polyclonal antibody specifically detects NFkB p100/p52 in Human, Mouse samples. It is validated for Western Blot
Specifications
| NFkB p100/p52 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Lyt10, LYT10LYT-10, nuclear factor NF-kappa-B p100 subunit, nuclear factor of kappa light chain gene enhancer in B-cells 2, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100), Oncogene Lyt-10, p52 | |
| A synthetic peptide corresponding to a sequence within amino acids 400-500 of human NFkB p100/p52 (NP_001070962.1). GGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHGQ | |
| 0.1 mL | |
| Apoptosis, Cancer, Cell Biology, Neurodegeneration, Neuroscience, Signal Transduction, Transcription Factors and Regulators | |
| 4791 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction