missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NFkB p100/p52 Antibody - Azide and BSA Free, Novus Biologicals™

NFkB p100/p52 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

€ 198.00 - € 468.00

Specifications

Antigen NFkB p100/p52
Dilution Western Blot 1:500-1:2000
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
18608150
View Documents
missing translation for 'viewProductCertificates'
Novus Biologicals
NBP2-93391-0.02ml 		0.02 mL This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 		N/A View alternative products
Save Up to  »
18687460
View Documents
missing translation for 'viewProductCertificates'
Novus Biologicals
NBP2-93391-0.1ml 		0.1 mL This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 		N/A View alternative products
Save Up to  »
Description

Description

NFkB p100/p52 Polyclonal antibody specifically detects NFkB p100/p52 in Human, Mouse samples. It is validated for Western Blot
Specifications

Specifications

NFkB p100/p52
Western Blot
Unconjugated
Rabbit
Apoptosis, Cancer, Cell Biology, Neurodegeneration, Neuroscience, Signal Transduction, Transcription Factors and Regulators
PBS (pH 7.3), 50% glycerol
4791
IgG
Affinity purified
Western Blot 1:500-1:2000
Polyclonal
Purified
RUO
Human, Mouse
DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Lyt10, LYT10LYT-10, nuclear factor NF-kappa-B p100 subunit, nuclear factor of kappa light chain gene enhancer in B-cells 2, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100), Oncogene Lyt-10, p52
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human NFkB p100/p52 (NP_001070962.1). GGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHGQ
Primary
Store at -20°C. Avoid freeze-thaw cycles.
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Product Certifications
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt